The Nutrition Magazine
Menu
Recipes

The Weeknight Mediterranean Bowl

Twenty minutes, one sheet pan, and the kind of macro profile that holds up to actual nutritional scrutiny. This is the bowl that earned a place in our regular rotation.

Published April 15, 2026
5 min read
The Weeknight Mediterranean Bowl

A weeknight Mediterranean grain bowl with chickpeas, lemon-roasted vegetables, and herbed yogurt. Twenty minutes, real macros, and reliably good.

There is a category of weeknight cooking that solves the same three problems at once: it has to come together in under thirty minutes, it has to be nutritionally honest, and it has to taste good enough that you’ll actually make it twice. This bowl earned its place by clearing all three.

Roasted chickpeas and vegetables on a Mediterranean-leaning grain base, with a lemon-herb yogurt that does most of the flavor work. The macros are real. The components reheat. The total active time is about ten minutes if you’re efficient.

Ingredients (serves 4)

  • 2 cups cooked farro or pearled barley (about 3/4 cup dry)
  • 1 can (15 oz) chickpeas, drained, rinsed, patted dry
  • 1 medium zucchini, diced
  • 1 red bell pepper, diced
  • 1 small red onion, sliced into thin wedges
  • 1 pint cherry tomatoes
  • 3 tbsp extra-virgin olive oil, divided
  • 1 tsp ground cumin
  • 1 tsp smoked paprika
  • 1/2 tsp ground coriander
  • Kosher salt and black pepper

For the herbed yogurt:

  • 1 cup full-fat Greek yogurt
  • 2 tbsp lemon juice
  • 1 small garlic clove, grated
  • 2 tbsp finely chopped fresh dill (or mint, or parsley — use what you have)
  • Pinch salt

To finish: chopped cucumber, crumbled feta (optional), more lemon, fresh herbs.

Method

  1. Heat the oven to 425°F. Line a sheet pan with parchment.

  2. Cook the grain. If you don’t have leftover farro or barley already cooked, get it on the stove first — it takes 25–30 minutes and will finish around the same time as the vegetables.

  3. Roast the vegetables and chickpeas. Spread the chickpeas, zucchini, bell pepper, onion, and tomatoes on the sheet pan. Drizzle with 2 tablespoons of olive oil. Sprinkle the cumin, smoked paprika, coriander, a generous pinch of salt, and several grinds of pepper. Toss with your hands until everything is coated. Roast for 20–22 minutes, tossing once at the halfway point, until the chickpeas are crisp at the edges and the tomatoes have burst.

  4. Make the yogurt. While the pan is in the oven: combine the yogurt, lemon juice, grated garlic, herbs, and salt. Taste; adjust lemon and salt.

  5. Assemble. Divide the warm grain among four bowls. Top with the roasted vegetables and chickpeas. Drizzle the remaining tablespoon of olive oil. Spoon the yogurt generously over the top. Finish with cucumber, feta if using, more herbs, and a squeeze of lemon.

What’s actually in this

The macro breakdown, per bowl, sourced from USDA FoodData Central reference values:

ComponentkcalProtein (g)Carbs (g)Fat (g)
Farro (1/2 cup cooked)1104231
Chickpeas (1/4 can)1055172
Roasted vegetables (1/4 batch)702122
Olive oil (3/4 tbsp)900010
Greek yogurt (1/4 cup)60643
Feta (optional, 1 tbsp)30202
Total (without feta)~540~24~68~19

About 18% of calories from protein, 50% from carbs, 32% from fat. Decent fiber from the chickpeas, vegetables, and whole grain (around 12 g per bowl). Enough acid and fat to keep the eating experience satisfying.

If you’re tracking and want more protein, the cleanest add is 4 oz grilled chicken thigh (adds about 30 g protein and 180 kcal) or a soft-boiled egg (+6 g, +70 kcal).

A few notes from the kitchen

The chickpeas are the variable. Patting them genuinely dry before roasting is the difference between crisped chickpeas and steamed chickpeas. Worth the extra minute with a kitchen towel.

The yogurt scales the dish. A generous spoonful per bowl, not a polite drizzle. The lemon-and-garlic combination is what makes this bowl read as Mediterranean rather than as a generic grain bowl.

The grain is interchangeable. Farro is the default; pearled barley, freekeh, or brown rice all work. Quinoa works but changes the texture meaningfully.

This is the kind of recipe that earns repeat appearances because it doesn’t ask much and reliably delivers. Twenty minutes, real food, honest macros. That’s the whole proposition.

recipesmediterraneanweeknightvegetarianhigh-protein

Frequently asked

What's the macro breakdown per bowl?

Roughly 540 kcal, 24 g protein, 68 g carbs, 19 g fat. Protein scales meaningfully if you add 4 oz grilled chicken (+30 g protein, +180 kcal).

Can this be made vegan?

Yes — swap the yogurt for a thick coconut or cashew yogurt and the macros stay close. You'll lose 4–5 g of protein from the dairy swap; consider adding hemp seeds to make it up.

Does it hold up as meal prep?

The vegetables and chickpeas keep four days in the fridge. Dress and add the yogurt the day you eat it. The grain base reheats best with a tablespoon of water stirred in.

Sources

  1. USDA FoodData Central

Published April 15, 2026 · Last reviewed April 15, 2026

The dispatch

A weekly read on what we eat

Original reporting on nutrition science, food, and the apps that shape how we eat. One email a week. No tricks.

No spam. Unsubscribe anytime.